SCOPe 2.07: Domain d3p1fa1: 3p1f A:1081-1197

Lineage for d3p1fa1 (3p1f A:1081-1197)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein automated matches [190366] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (67 PDB entries)

8. Domain d3p1fa1: 3p1f A:1081-1197 [183451]
   Other proteins in same PDB: d3p1fa2
   automated match to d1jspb_
   complexed with 3pf, edo, k

Details for d3p1fa1

PDB Entry: 3p1f, 1.63 Å

PDB Description: crystal structure of the bromodomain of human crebbp in complex with a hydroquinazolin ligand

PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d3p1fa1:

Sequence; same for both SEQRES and ATOM records:

>d3p1fa1 a.29.2.1 (A:1081-1197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

Timeline for d3p1fa1:

• d3p1fa1 first appeared in SCOPe 2.01, called d3p1fa_
  
• d3p1fa1 appears in SCOPe 2.06
  
• d3p1fa1 appears in the current release, SCOPe 2.08