Lineage for d1find2 (1fin D:310-432)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49209Fold a.74: Cyclin-like [47953] (1 superfamily)
  4. 49210Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
  5. 49211Family a.74.1.1: Cyclin [47955] (3 proteins)
  6. 49212Protein Cyclin A [47956] (2 species)
  7. 49216Species Human (Homo sapiens) [TaxId:9606] [47957] (5 PDB entries)
  8. 49226Domain d1find2: 1fin D:310-432 [18345]
    Other proteins in same PDB: d1fina_, d1finc_

Details for d1find2

PDB Entry: 1fin (more details), 2.3 Å

PDB Description: cyclin a-cyclin-dependent kinase 2 complex

SCOP Domain Sequences for d1find2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1find2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens)}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOP Domain Coordinates for d1find2:

Click to download the PDB-style file with coordinates for d1find2.
(The format of our PDB-style files is described here.)

Timeline for d1find2: