SCOPe 2.05: Domain d3p1db_: 3p1d B:

Lineage for d3p1db_ (3p1d B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (5 proteins)

6. Protein automated matches [190366] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (31 PDB entries)

8. Domain d3p1db_: 3p1d B: [183448]
   automated match to d1jspb_
   complexed with k, mb3, scn

Details for d3p1db_

PDB Entry: 3p1d, 1.86 Å

PDB Description: crystal structure of the bromodomain of human crebbp in complex with n-methyl-2-pyrrolidone (nmp)

PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d3p1db_:

Sequence; same for both SEQRES and ATOM records:

>d3p1db_ a.29.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl

Timeline for d3p1db_:

• d3p1db_ first appeared in SCOPe 2.01
  
• d3p1db_ appears in SCOPe 2.04
  
• d3p1db_ appears in SCOPe 2.06
  
• d3p1db_ appears in the current release, SCOPe 2.08