Lineage for d3p1db_ (3p1d B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1267072Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1267073Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1267074Family a.29.2.1: Bromodomain [47371] (5 proteins)
  6. 1267103Protein automated matches [190366] (1 species)
    not a true protein
  7. 1267104Species Human (Homo sapiens) [TaxId:9606] [187201] (16 PDB entries)
  8. 1267119Domain d3p1db_: 3p1d B: [183448]
    automated match to d1jspb_
    complexed with k, mb3, scn

Details for d3p1db_

PDB Entry: 3p1d (more details), 1.86 Å

PDB Description: crystal structure of the bromodomain of human crebbp in complex with n-methyl-2-pyrrolidone (nmp)
PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d3p1db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p1db_ a.29.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl

SCOPe Domain Coordinates for d3p1db_:

Click to download the PDB-style file with coordinates for d3p1db_.
(The format of our PDB-style files is described here.)

Timeline for d3p1db_: