| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.1: Bromodomain [47371] (5 proteins) |
| Protein automated matches [190366] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187201] (16 PDB entries) |
| Domain d3p1da_: 3p1d A: [183447] automated match to d1jspb_ complexed with k, mb3, scn |
PDB Entry: 3p1d (more details), 1.86 Å
SCOPe Domain Sequences for d3p1da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p1da_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
Timeline for d3p1da_: