Lineage for d3p1da_ (3p1d A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706695Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2706816Protein automated matches [190366] (2 species)
    not a true protein
  7. 2706817Species Human (Homo sapiens) [TaxId:9606] [187201] (46 PDB entries)
  8. 2706866Domain d3p1da_: 3p1d A: [183447]
    automated match to d1jspb_
    complexed with k, mb3, scn

Details for d3p1da_

PDB Entry: 3p1d (more details), 1.86 Å

PDB Description: crystal structure of the bromodomain of human crebbp in complex with n-methyl-2-pyrrolidone (nmp)
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d3p1da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p1da_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

SCOPe Domain Coordinates for d3p1da_:

Click to download the PDB-style file with coordinates for d3p1da_.
(The format of our PDB-style files is described here.)

Timeline for d3p1da_: