![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.133: RbsD-like [102545] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest |
![]() | Superfamily c.133.1: RbsD-like [102546] (2 families) ![]() |
![]() | Family c.133.1.0: automated matches [191558] (1 protein) not a true family |
![]() | Protein automated matches [190962] (7 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:93061] [189968] (2 PDB entries) |
![]() | Domain d3p13c_: 3p13 C: [183439] automated match to d1ogca_ complexed with rip |
PDB Entry: 3p13 (more details), 2.35 Å
SCOPe Domain Sequences for d3p13c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p13c_ c.133.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 93061]} avlnehiskaiatighfdlltindagmpipndhrridlavtknlprfidvlatvleemei qkiylaeeikehnptqlqqikqlisseieiifipheemksnlahplnkgnirtgettpys nialesnvtf
Timeline for d3p13c_: