Lineage for d3p13b_ (3p13 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1886150Fold c.133: RbsD-like [102545] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest
  4. 1886151Superfamily c.133.1: RbsD-like [102546] (2 families) (S)
  5. 1886178Family c.133.1.0: automated matches [191558] (1 protein)
    not a true family
  6. 1886179Protein automated matches [190962] (6 species)
    not a true protein
  7. 1886221Species Staphylococcus aureus [TaxId:93061] [189968] (2 PDB entries)
  8. 1886223Domain d3p13b_: 3p13 B: [183438]
    automated match to d1ogca_
    complexed with rip

Details for d3p13b_

PDB Entry: 3p13 (more details), 2.35 Å

PDB Description: complex structure of d-ribose pyranase sa240 with d-ribose
PDB Compounds: (B:) D-ribose pyranase

SCOPe Domain Sequences for d3p13b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p13b_ c.133.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]}
avlnehiskaiatighfdlltindagmpipndhrridlavtknlprfidvlatvleemei
qkiylaeeikehnptqlqqikqlisseieiifipheemksnlahplnkgnirtgettpys
nialesnvt

SCOPe Domain Coordinates for d3p13b_:

Click to download the PDB-style file with coordinates for d3p13b_.
(The format of our PDB-style files is described here.)

Timeline for d3p13b_: