Lineage for d3ozra_ (3ozr A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1175720Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1175721Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1175722Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 1175741Protein automated matches [190251] (3 species)
    not a true protein
  7. 1175750Species Norway rat (Rattus norvegicus) [TaxId:10116] [187033] (20 PDB entries)
  8. 1175765Domain d3ozra_: 3ozr A: [183423]
    automated match to d1h1da_
    protein/RNA complex; complexed with cl, mg, ozr

Details for d3ozra_

PDB Entry: 3ozr (more details), 1.73 Å

PDB Description: rat catechol o-methyltransferase in complex with a catechol-type, bisubstrate inhibitor, no substituent in the adenine site - humanized form
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d3ozra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ozra_ c.66.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmeinpdcaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqgp

SCOPe Domain Coordinates for d3ozra_:

Click to download the PDB-style file with coordinates for d3ozra_.
(The format of our PDB-style files is described here.)

Timeline for d3ozra_: