Lineage for d1finb1 (1fin B:173-309)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331190Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2331191Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2331192Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2331205Protein Cyclin A [47956] (2 species)
  7. 2331247Species Human (Homo sapiens) [TaxId:9606] [47957] (86 PDB entries)
    Uniprot P20248 175-432
  8. 2331362Domain d1finb1: 1fin B:173-309 [18342]
    Other proteins in same PDB: d1fina_, d1finc_
    complexed with atp

Details for d1finb1

PDB Entry: 1fin (more details), 2.3 Å

PDB Description: cyclin a-cyclin-dependent kinase 2 complex
PDB Compounds: (B:) cyclin a

SCOPe Domain Sequences for d1finb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1finb1 a.74.1.1 (B:173-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
nevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetl
hlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvl
rmehlvlkvltfdlaap

SCOPe Domain Coordinates for d1finb1:

Click to download the PDB-style file with coordinates for d1finb1.
(The format of our PDB-style files is described here.)

Timeline for d1finb1: