SCOPe 2.08: Domain d3ozdb_: 3ozd B:

Lineage for d3ozdb_ (3ozd B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53175] (17 PDB entries)
   Uniprot Q13126

8. Domain d3ozdb_: 3ozd B: [183412]
   automated match to d1cb0a_
   complexed with 4ct

Details for d3ozdb_

PDB Entry: 3ozd, 2.1 Å

PDB Description: crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase in complex with pcl-phenylthiodadmeimma

PDB Compounds: (B:) S-methyl-5'-thioadenosine phosphorylase

SCOPe Domain Sequences for d3ozdb_:

Sequence; same for both SEQRES and ATOM records:

>d3ozdb_ c.56.2.1 (B:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Human (Homo sapiens) [TaxId: 9606]}
avkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvllarhgrqhtim
pskvnyqaniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmrpqsfydgs
hscargvchipmaepfcpktrevlietakklglrchskgtmvtiegprfssraesfmfrt
wgadvinmttvpevvlakeagicyasiamatdydcwkeheeavsvdrvlktlkenankak
slllttipqigstewsetlhnlknmaqfsvllp

Timeline for d3ozdb_:

• d3ozdb_ first appeared in SCOPe 2.01
  
• d3ozdb_ appears in SCOPe 2.07