Lineage for d3oz7b1 (3oz7 B:2-415)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141948Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2141949Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2141950Family c.86.1.1: Phosphoglycerate kinase [53749] (2 protein domains)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 2141951Protein Phosphoglycerate kinase [53750] (8 species)
  7. 2141960Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [89783] (3 PDB entries)
  8. 2141962Domain d3oz7b1: 3oz7 B:2-415 [183409]
    Other proteins in same PDB: d3oz7a2, d3oz7b2
    automated match to d1ltka_
    complexed with so4

Details for d3oz7b1

PDB Entry: 3oz7 (more details), 2.7 Å

PDB Description: Crystal Structure of 3-Phosphopglycerate Kinase of Plasmodium falciparum
PDB Compounds: (B:) phosphoglycerate kinase

SCOPe Domain Sequences for d3oz7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oz7b1 c.86.1.1 (B:2-415) Phosphoglycerate kinase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
lgnklsisdlkdiknkkvlvrvdfnvpiengiikdtnritatlptinhlkkegaskiili
shcgrpdglrnekytlkpvaetlkgllgeevlflndcvgkevedkinaakensvillenl
rfhieeegkgvdangnkvkankedvekfqndltkladvfindafgtahrahssmvgvkln
vkasgflmkkeleyfskalenpqrpllailggakvsdkiqliknlldkvdrmiigggmay
tfkkvlnnmkigtslfdeagskivgeimekakaknvqiflpvdfkiadnfdnnantkfvt
deegipdnwmgldagpksienykdviltsktviwngpqgvfempnfakgsieclnlvvev
tkkgaitivgggdtaslveqqnkkneishvstgggaslellegkelpgvlalsn

SCOPe Domain Coordinates for d3oz7b1:

Click to download the PDB-style file with coordinates for d3oz7b1.
(The format of our PDB-style files is described here.)

Timeline for d3oz7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3oz7b2