Lineage for d3oywa_ (3oyw A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050578Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2050595Protein Galectin-1 [100925] (5 species)
  7. 2050612Species Human (Homo sapiens) [TaxId:9606] [101638] (27 PDB entries)
    Uniprot P09382
  8. 2050645Domain d3oywa_: 3oyw A: [183406]
    automated match to d1gzwa_
    complexed with tdg

Details for d3oywa_

PDB Entry: 3oyw (more details), 2.5 Å

PDB Description: crystal structure of human galectin-1 in complex with thiodigalactoside
PDB Compounds: (A:) galectin-1

SCOPe Domain Sequences for d3oywa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oywa_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd

SCOPe Domain Coordinates for d3oywa_:

Click to download the PDB-style file with coordinates for d3oywa_.
(The format of our PDB-style files is described here.)

Timeline for d3oywa_: