SCOPe 2.05: Domain d3oywa_: 3oyw A:

Lineage for d3oywa_ (3oyw A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101638] (19 PDB entries)
   Uniprot P09382

8. Domain d3oywa_: 3oyw A: [183406]
   automated match to d1gzwa_
   complexed with tdg

Details for d3oywa_

PDB Entry: 3oyw, 2.5 Å

PDB Description: crystal structure of human galectin-1 in complex with thiodigalactoside

PDB Compounds: (A:) galectin-1

SCOPe Domain Sequences for d3oywa_:

Sequence; same for both SEQRES and ATOM records:

>d3oywa_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd

Timeline for d3oywa_:

• d3oywa_ first appeared in SCOPe 2.01
  
• d3oywa_ appears in SCOPe 2.04
  
• d3oywa_ appears in SCOPe 2.06
  
• d3oywa_ appears in the current release, SCOPe 2.08