| Class b: All beta proteins [48724] (178 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
| Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
| Protein Galectin-1 [100925] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [101638] (32 PDB entries) Uniprot P09382 |
| Domain d3oy8b_: 3oy8 B: [183405] automated match to d1gzwa_ complexed with gal, gco |
PDB Entry: 3oy8 (more details), 2.19 Å
SCOPe Domain Sequences for d3oy8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oy8b_ b.29.1.3 (B:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd
Timeline for d3oy8b_: