Lineage for d3oy8b_ (3oy8 B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 944452Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 944469Protein Galectin-1 [100925] (5 species)
  7. 944486Species Human (Homo sapiens) [TaxId:9606] [101638] (10 PDB entries)
    Uniprot P09382
  8. 944500Domain d3oy8b_: 3oy8 B: [183405]
    automated match to d1gzwa_

Details for d3oy8b_

PDB Entry: 3oy8 (more details), 2.19 Å

PDB Description: crystal structure of human galectin-1 in complex with lactobionic acid
PDB Compounds: (B:) galectin-1

SCOPe Domain Sequences for d3oy8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oy8b_ b.29.1.3 (B:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd

SCOPe Domain Coordinates for d3oy8b_:

Click to download the PDB-style file with coordinates for d3oy8b_.
(The format of our PDB-style files is described here.)

Timeline for d3oy8b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3oy8a_