Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (12 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187169] (35 PDB entries) |
Domain d3oy3b_: 3oy3 B: [183401] automated match to d1opjb_ complexed with xy3; mutant |
PDB Entry: 3oy3 (more details), 1.95 Å
SCOPe Domain Sequences for d3oy3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oy3b_ d.144.1.7 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea avmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevsavvllymatqi ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelg
Timeline for d3oy3b_: