SCOPe 2.08: Domain d3oy3b1: 3oy3 B:229-511

Lineage for d3oy3b1 (3oy3 B:229-511)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
   PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase

7. Species Mouse (Mus musculus) [TaxId:10090] [56167] (16 PDB entries)

8. Domain d3oy3b1: 3oy3 B:229-511 [183401]
   Other proteins in same PDB: d3oy3a2, d3oy3b2
   automated match to d1opjb_
   complexed with xy3; mutant

Details for d3oy3b1

PDB Entry: 3oy3, 1.95 Å

PDB Description: Crystal structure of ABL T315I mutant kinase domain bound with a DFG-out inhibitor AP24589

PDB Compounds: (B:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d3oy3b1:

Sequence; same for both SEQRES and ATOM records:

>d3oy3b1 d.144.1.7 (B:229-511) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa
vmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevsavvllymatqis
sameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtap
eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv
yelmracwqwnpsdrpsfaeihqafetmfqessisdevekelg

Timeline for d3oy3b1:

• d3oy3b1 first appeared in SCOPe 2.01, called d3oy3b_
  
• d3oy3b1 appears in SCOPe 2.07