Lineage for d3oy3a_ (3oy3 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1043604Protein automated matches [190091] (8 species)
    not a true protein
  7. 1043998Species Mouse (Mus musculus) [TaxId:10090] [187169] (25 PDB entries)
  8. 1044026Domain d3oy3a_: 3oy3 A: [183400]
    automated match to d1opjb_
    complexed with xy3; mutant

Details for d3oy3a_

PDB Entry: 3oy3 (more details), 1.95 Å

PDB Description: Crystal structure of ABL T315I mutant kinase domain bound with a DFG-out inhibitor AP24589
PDB Compounds: (A:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d3oy3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oy3a_ d.144.1.7 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
avmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevsavvllymatqi
ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelg

SCOPe Domain Coordinates for d3oy3a_:

Click to download the PDB-style file with coordinates for d3oy3a_.
(The format of our PDB-style files is described here.)

Timeline for d3oy3a_: