SCOPe 2.06: Domain d3oxza1: 3oxz A:229-511

Lineage for d3oxza1 (3oxz A:229-511)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187169] (38 PDB entries)

8. Domain d3oxza1: 3oxz A:229-511 [183399]
   Other proteins in same PDB: d3oxza2
   automated match to d1opjb_
   complexed with 0li

Details for d3oxza1

PDB Entry: 3oxz, 2.2 Å

PDB Description: Crystal structure of ABL kinase domain bound with a DFG-out inhibitor AP24534

PDB Compounds: (A:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d3oxza1:

Sequence, based on SEQRES records:

>d3oxza1 d.144.1.7 (A:229-511) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa
vmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqis
sameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtap
eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv
yelmracwqwnpsdrpsfaeihqafetmfqessisdevekelg

Sequence, based on observed residues (ATOM records):

>d3oxza1 d.144.1.7 (A:229-511) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlveeflkeaavmkeik
hpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissameyl
ekknfihrdlaarnclvgenhlvkvadfglsytgakfpikwtapeslaynkfsiksdvwa
fgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrp
sfaeihqafetmfqessisdevekelg

Timeline for d3oxza1:

• d3oxza1 first appeared in SCOPe 2.01, called d3oxza_
  
• d3oxza1 was called d3oxza_ in SCOPe 2.05
  
• d3oxza1 appears in SCOPe 2.07
  
• d3oxza1 appears in the current release, SCOPe 2.08