Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Abelsone tyrosine kinase (abl) [56166] (2 species) PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase |
Species Mouse (Mus musculus) [TaxId:10090] [56167] (16 PDB entries) |
Domain d3oxza1: 3oxz A:229-511 [183399] Other proteins in same PDB: d3oxza2 automated match to d1opjb_ complexed with 0li |
PDB Entry: 3oxz (more details), 2.2 Å
SCOPe Domain Sequences for d3oxza1:
Sequence, based on SEQRES records: (download)
>d3oxza1 d.144.1.7 (A:229-511) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa vmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqis sameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtap eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv yelmracwqwnpsdrpsfaeihqafetmfqessisdevekelg
>d3oxza1 d.144.1.7 (A:229-511) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} spnydkwemertditmkhklgggqygevyegvwkkysltvavktlveeflkeaavmkeik hpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissameyl ekknfihrdlaarnclvgenhlvkvadfglsytgakfpikwtapeslaynkfsiksdvwa fgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrp sfaeihqafetmfqessisdevekelg
Timeline for d3oxza1: