Lineage for d3oxvd_ (3oxv D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1548219Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1548235Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. 1548236Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [187932] (17 PDB entries)
  8. 1548250Domain d3oxvd_: 3oxv D: [183390]
    automated match to d1kzka_
    complexed with 478, act, gol, po4, so4

Details for d3oxvd_

PDB Entry: 3oxv (more details), 1.75 Å

PDB Description: crystal structure of hiv-1 i50v, a71 protease in complex with the protease inhibitor amprenavir.
PDB Compounds: (D:) hiv-1 protease

SCOPe Domain Sequences for d3oxvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oxvd_ b.50.1.1 (D:) Human immunodeficiency virus type 1 protease {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
qipieicghkvigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d3oxvd_:

Click to download the PDB-style file with coordinates for d3oxvd_.
(The format of our PDB-style files is described here.)

Timeline for d3oxvd_: