| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
| Family a.102.4.4: Complement components [48251] (4 proteins) probably related to other families, but has no known enzymatic activity |
| Protein automated matches [190371] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187209] (1 PDB entry) |
| Domain d3oxuc1: 3oxu C:3-294 [183389] Other proteins in same PDB: d3oxua2, d3oxuc2 automated match to d1ghqa_ complexed with gol |
PDB Entry: 3oxu (more details), 2.1 Å
SCOPe Domain Sequences for d3oxuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oxuc1 a.102.4.4 (C:3-294) automated matches {Human (Homo sapiens) [TaxId: 9606]}
daerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytq
qlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpd
gvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdf
leanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsy
allallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap
Timeline for d3oxuc1: