Class a: All alpha proteins [46456] (286 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) |
Family a.102.4.4: Complement components [48251] (4 proteins) probably related to other families, but has no known enzymatic activity |
Protein automated matches [190371] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187209] (1 PDB entry) |
Domain d3oxua_: 3oxu A: [183387] automated match to d1ghqa_ complexed with gol |
PDB Entry: 3oxu (more details), 2.1 Å
SCOPe Domain Sequences for d3oxua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oxua_ a.102.4.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} efrdaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkg ytqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekq kpdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitka gdfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynvea tsyallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap
Timeline for d3oxua_: