SCOPe 2.05: Domain d3oxua_: 3oxu A:

Lineage for d3oxua_ (3oxu A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.4: Complement components [48251] (4 proteins)
   probably related to other families, but has no known enzymatic activity

6. Protein automated matches [190371] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187209] (1 PDB entry)

8. Domain d3oxua_: 3oxu A: [183387]
   automated match to d1ghqa_
   complexed with gol

Details for d3oxua_

PDB Entry: 3oxu, 2.1 Å

PDB Description: Complement components factor H CCP19-20 and C3d in complex

PDB Compounds: (A:) Complement C3

SCOPe Domain Sequences for d3oxua_:

Sequence; same for both SEQRES and ATOM records:

>d3oxua_ a.102.4.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efrdaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkg
ytqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekq
kpdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitka
gdfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynvea
tsyallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap

Timeline for d3oxua_:

• d3oxua_ first appeared in SCOPe 2.01
  
• d3oxua_ appears in SCOPe 2.04
  
• d3oxua_ is called d3oxua1 in SCOPe 2.06
  
• d3oxua_ appears in the current release, SCOPe 2.08, called d3oxua1