Lineage for d3oxua1 (3oxu A:3-294)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722506Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2722786Family a.102.4.4: Complement components [48251] (4 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 2722839Protein automated matches [190371] (1 species)
    not a true protein
  7. 2722840Species Human (Homo sapiens) [TaxId:9606] [187209] (1 PDB entry)
  8. 2722841Domain d3oxua1: 3oxu A:3-294 [183387]
    Other proteins in same PDB: d3oxua2, d3oxuc2
    automated match to d1ghqa_
    complexed with gol

Details for d3oxua1

PDB Entry: 3oxu (more details), 2.1 Å

PDB Description: Complement components factor H CCP19-20 and C3d in complex
PDB Compounds: (A:) Complement C3

SCOPe Domain Sequences for d3oxua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oxua1 a.102.4.4 (A:3-294) automated matches {Human (Homo sapiens) [TaxId: 9606]}
daerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytq
qlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpd
gvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdf
leanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsy
allallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap

SCOPe Domain Coordinates for d3oxua1:

Click to download the PDB-style file with coordinates for d3oxua1.
(The format of our PDB-style files is described here.)

Timeline for d3oxua1: