| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (5 families) ![]() |
| Family d.13.1.0: automated matches [191614] (1 protein) not a true family |
| Protein automated matches [191122] (9 species) not a true protein |
| Species Entamoeba histolytica [TaxId:294381] [189454] (3 PDB entries) |
| Domain d3oxka_: 3oxk A: [183379] automated match to d1xqub_ complexed with 5gp, eoh, zn |
PDB Entry: 3oxk (more details), 1.55 Å
SCOPe Domain Sequences for d3oxka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oxka_ d.13.1.0 (A:) automated matches {Entamoeba histolytica [TaxId: 294381]}
gsmadscifckiaqkqipstivyeddeifafkdinpiapihilvipkqhiaslneiteen
eafigkvlykvsligkkecpegyrvvnnigedagqtvkhihfhilggkklawdkl
Timeline for d3oxka_: