Lineage for d3oxka_ (3oxk A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401193Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 1401194Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 1401348Family d.13.1.0: automated matches [191614] (1 protein)
    not a true family
  6. 1401349Protein automated matches [191122] (8 species)
    not a true protein
  7. 1401358Species Entamoeba histolytica [TaxId:294381] [189454] (3 PDB entries)
  8. 1401360Domain d3oxka_: 3oxk A: [183379]
    automated match to d1xqub_
    complexed with 5gp, eoh, zn

Details for d3oxka_

PDB Entry: 3oxk (more details), 1.55 Å

PDB Description: crystal structure of a histidine triad family protein from entamoeba histolytica, bound to gmp
PDB Compounds: (A:) Putative histidine triad family protein

SCOPe Domain Sequences for d3oxka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oxka_ d.13.1.0 (A:) automated matches {Entamoeba histolytica [TaxId: 294381]}
gsmadscifckiaqkqipstivyeddeifafkdinpiapihilvipkqhiaslneiteen
eafigkvlykvsligkkecpegyrvvnnigedagqtvkhihfhilggkklawdkl

SCOPe Domain Coordinates for d3oxka_:

Click to download the PDB-style file with coordinates for d3oxka_.
(The format of our PDB-style files is described here.)

Timeline for d3oxka_: