Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.3: Quinone reductase [52235] (4 proteins) binds FAD |
Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52241] (44 PDB entries) |
Domain d3ox3b_: 3ox3 B: [183365] automated match to d1qr2a_ complexed with 4x4, fad, zn |
PDB Entry: 3ox3 (more details), 1.8 Å
SCOPe Domain Sequences for d3ox3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ox3b_ c.23.5.3 (B:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]} gkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtlsn pevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvlc qgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcgf kvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfg
Timeline for d3ox3b_: