SCOPe 2.05: Domain d3ox1b_: 3ox1 B:

Lineage for d3ox1b_ (3ox1 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
   binds FAD

6. Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52241] (53 PDB entries)

8. Domain d3ox1b_: 3ox1 B: [183361]
   automated match to d1qr2a_
   complexed with 695, fad, zn

Details for d3ox1b_

PDB Entry: 3ox1, 2 Å

PDB Description: x-ray structural study of quinone reductase ii inhibition by compounds with micromolar to nanomolar range ic50 values

PDB Compounds: (B:) Ribosyldihydronicotinamide dehydrogenase [quinone]

SCOPe Domain Sequences for d3ox1b_:

Sequence; same for both SEQRES and ATOM records:

>d3ox1b_ c.23.5.3 (B:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
gkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtlsn
pevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvlc
qgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcgf
kvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

Timeline for d3ox1b_:

• d3ox1b_ first appeared in SCOPe 2.01
  
• d3ox1b_ appears in SCOPe 2.04
  
• d3ox1b_ appears in SCOPe 2.06
  
• d3ox1b_ appears in the current release, SCOPe 2.08