Lineage for d1jsub1 (1jsu B:175-309)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273869Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1273870Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1273871Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1273884Protein Cyclin A [47956] (2 species)
  7. 1273920Species Human (Homo sapiens) [TaxId:9606] [47957] (73 PDB entries)
    Uniprot P20248 175-432
  8. 1273989Domain d1jsub1: 1jsu B:175-309 [18336]
    Other proteins in same PDB: d1jsua_, d1jsuc_
    complexed with so4

Details for d1jsub1

PDB Entry: 1jsu (more details), 2.3 Å

PDB Description: p27(kip1)/cyclin a/cdk2 complex
PDB Compounds: (B:) cyclin a

SCOPe Domain Sequences for d1jsub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jsub1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

SCOPe Domain Coordinates for d1jsub1:

Click to download the PDB-style file with coordinates for d1jsub1.
(The format of our PDB-style files is described here.)

Timeline for d1jsub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jsub2