Lineage for d3owyb_ (3owy B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896290Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 1896291Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 1896362Species Pseudomonas putida [TaxId:303] [54437] (41 PDB entries)
    Uniprot P07445
  8. 1896437Domain d3owyb_: 3owy B: [183353]
    automated match to d1e3vb_
    complexed with equ

Details for d3owyb_

PDB Entry: 3owy (more details), 2.3 Å

PDB Description: crystal structure of ketosteroid isomerase d40n/c69s/c81s/c97s/m105c-cn from p. putida with bound equilenin
PDB Compounds: (B:) steroid delta-isomerase

SCOPe Domain Sequences for d3owyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3owyb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvrasltgpvrashngsgampfrvemvwngqpsaldvidvxrfdehgriqtmqayws
evnlsvrep

SCOPe Domain Coordinates for d3owyb_:

Click to download the PDB-style file with coordinates for d3owyb_.
(The format of our PDB-style files is described here.)

Timeline for d3owyb_: