SCOPe 2.04: Domain d1d1da2: 1d1d A:11-150

Lineage for d1d1da2 (1d1d A:11-150)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein RSV capsid protein [47951] (1 species)

7. Species Rous sarcoma virus [TaxId:11886] [47952] (3 PDB entries)

8. Domain d1d1da2: 1d1d A:11-150 [18335]
   Other proteins in same PDB: d1d1da1

Details for d1d1da2

PDB Entry: 1d1d

PDB Description: nmr solution structure of the capsid protein from rous sarcoma virus

PDB Compounds: (A:) protein (capsid protein)

SCOPe Domain Sequences for d1d1da2:

Sequence; same for both SEQRES and ATOM records:

>d1d1da2 a.73.1.1 (A:11-150) RSV capsid protein {Rous sarcoma virus [TaxId: 11886]}
wtplepklitrladtvrtkglrspitmaevealmsspllphdvtnlmrvilgpapyalwm
dawgvqlqtviaaatrdprhpangqgrgertnldrlkgladgmvgnpqgqaallrpgelv
aitasalqafrevarlaepa

Timeline for d1d1da2:

• d1d1da2 first appeared (with stable ids) in SCOP 1.55
  
• d1d1da2 appears in SCOPe 2.03
  
• d1d1da2 appears in SCOPe 2.05
  
• d1d1da2 appears in the current release, SCOPe 2.08