Lineage for d1d1da2 (1d1d A:11-150)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495228Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1495229Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 1495230Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1495348Protein RSV capsid protein [47951] (1 species)
  7. 1495349Species Rous sarcoma virus [TaxId:11886] [47952] (3 PDB entries)
  8. 1495353Domain d1d1da2: 1d1d A:11-150 [18335]
    Other proteins in same PDB: d1d1da1

Details for d1d1da2

PDB Entry: 1d1d (more details)

PDB Description: nmr solution structure of the capsid protein from rous sarcoma virus
PDB Compounds: (A:) protein (capsid protein)

SCOPe Domain Sequences for d1d1da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1da2 a.73.1.1 (A:11-150) RSV capsid protein {Rous sarcoma virus [TaxId: 11886]}
wtplepklitrladtvrtkglrspitmaevealmsspllphdvtnlmrvilgpapyalwm
dawgvqlqtviaaatrdprhpangqgrgertnldrlkgladgmvgnpqgqaallrpgelv
aitasalqafrevarlaepa

SCOPe Domain Coordinates for d1d1da2:

Click to download the PDB-style file with coordinates for d1d1da2.
(The format of our PDB-style files is described here.)

Timeline for d1d1da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d1da1