SCOPe 2.01: Domain d3owuc_: 3owu C:

Lineage for d3owuc_ (3owu C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins)

6. Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)

7. Species Pseudomonas putida [TaxId:303] [54437] (31 PDB entries)
   Uniprot P07445

8. Domain d3owuc_: 3owu C: [183348]
   automated match to d1e3vb_
   complexed with equ

Details for d3owuc_

PDB Entry: 3owu, 1.7 Å

PDB Description: crystal structure of ketosteroid isomerase d40n/c69s/c81s/c97s/f86c-cn from p. putida with bound equilenin

PDB Compounds: (C:) steroid delta-isomerase

SCOPe Domain Sequences for d3owuc_:

Sequence; same for both SEQRES and ATOM records:

>d3owuc_ d.17.4.3 (C:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvrasltgpvrashngsgampxrvemvwngqpsaldvidvmrfdehgriqtmqayws
evnlsvrep

Timeline for d3owuc_:

• d3owuc_ is new in SCOPe 2.01-stable
  
• d3owuc_ appears in SCOPe 2.02
  
• d3owuc_ appears in the current release, SCOPe 2.08