![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins) automatically mapped to Pfam PF12680 automatically mapped to Pfam PF02136 |
![]() | Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (3 species) |
![]() | Species Pseudomonas putida [TaxId:303] [54437] (61 PDB entries) Uniprot P07445 |
![]() | Domain d3owsa_: 3ows A: [183342] automated match to d1e3vb_ complexed with equ |
PDB Entry: 3ows (more details), 1.71 Å
SCOPe Domain Sequences for d3owsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3owsa_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl gggkvrasltgpvrashngsgampfrvemvwngqpsaldvidvmrfdehgriqtxqayws evnlsvrep
Timeline for d3owsa_: