Lineage for d1em9b_ (1em9 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000631Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2000632Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2000633Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 protein domains)
  6. 2000758Protein RSV capsid protein [47951] (1 species)
  7. 2000759Species Rous sarcoma virus [TaxId:11886] [47952] (3 PDB entries)
  8. 2000761Domain d1em9b_: 1em9 B: [18334]
    N-terminal domain only
    complexed with mg

Details for d1em9b_

PDB Entry: 1em9 (more details), 2.05 Å

PDB Description: rous sarcoma virus capsid protein: n-terminal domain
PDB Compounds: (B:) gag polyprotein capsid protein p27

SCOPe Domain Sequences for d1em9b_:

Sequence, based on SEQRES records: (download)

>d1em9b_ a.73.1.1 (B:) RSV capsid protein {Rous sarcoma virus [TaxId: 11886]}
pvviktegpawtplepklitrladtvrtkglrspitmaevealmsspllphdvtnlmrvi
lgpapyalwmdawgvqlqtviaaatrdprhpangqgrgertnlnrlkgladgmvgnpqgq
aallrpgelvaitasalqafrevarla

Sequence, based on observed residues (ATOM records): (download)

>d1em9b_ a.73.1.1 (B:) RSV capsid protein {Rous sarcoma virus [TaxId: 11886]}
pvvikpawtplepklitrladtvrtkglrspitmaevealmsspllphdvtnlmrvilgp
apyalwmdawgvqlqtviaaatrdprhpangqertnlnrlkgladgmvgnpqgqaallrp
gelvaitasalqafrevarla

SCOPe Domain Coordinates for d1em9b_:

Click to download the PDB-style file with coordinates for d1em9b_.
(The format of our PDB-style files is described here.)

Timeline for d1em9b_: