Lineage for d3owja_ (3owj A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1221227Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 1221228Species Human (Homo sapiens) [TaxId:9606] [75559] (29 PDB entries)
  8. 1221246Domain d3owja_: 3owj A: [183337]
    automated match to d1jwha_
    complexed with 1el

Details for d3owja_

PDB Entry: 3owj (more details), 1.85 Å

PDB Description: Human CK2 catalytic domain in complex with a pyridocarbazole derivative inhibitor
PDB Compounds: (A:) CSNK2A1 protein

SCOPe Domain Sequences for d3owja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3owja_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
gpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitnn
ekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfk
qlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefy
hpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydql
vriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfld
kllrydhqsrltareamehpyfytvvkd

SCOPe Domain Coordinates for d3owja_:

Click to download the PDB-style file with coordinates for d3owja_.
(The format of our PDB-style files is described here.)

Timeline for d3owja_: