Lineage for d3oweo_ (3owe O:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931683Protein automated matches [190119] (11 species)
    not a true protein
  7. 931803Species Mouse (Mus musculus) [TaxId:10090] [186842] (22 PDB entries)
  8. 931836Domain d3oweo_: 3owe O: [183333]
    automated match to d2aq2a1
    mutant

Details for d3oweo_

PDB Entry: 3owe (more details), 2.6 Å

PDB Description: Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain
PDB Compounds: (O:) Beta-chain

SCOPe Domain Sequences for d3oweo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oweo_ b.1.1.1 (O:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip
dgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl

SCOPe Domain Coordinates for d3oweo_:

Click to download the PDB-style file with coordinates for d3oweo_.
(The format of our PDB-style files is described here.)

Timeline for d3oweo_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3owek_