SCOPe 2.01: Domain d3ovxb_: 3ovx B:

Lineage for d3ovxb_ (3ovx B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (23 PDB entries)

8. Domain d3ovxb_: 3ovx B: [183327]
   automated match to d1ms6a_
   complexed with dms, o64

Details for d3ovxb_

PDB Entry: 3ovx, 1.49 Å

PDB Description: Cathepsin S in complex with a covalent inhibitor with an aldehyde warhead

PDB Compounds: (B:) cathepsin S

SCOPe Domain Sequences for d3ovxb_:

Sequence; same for both SEQRES and ATOM records:

>d3ovxb_ d.3.1.1 (B:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d3ovxb_:

• d3ovxb_ is new in SCOPe 2.01-stable
  
• d3ovxb_ appears in SCOPe 2.02
  
• d3ovxb_ appears in the current release, SCOPe 2.08