SCOPe 2.06: Domain d3ovxa_: 3ovx A:

Lineage for d3ovxa_ (3ovx A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (23 PDB entries)

8. Domain d3ovxa_: 3ovx A: [183326]
   automated match to d1ms6a_
   complexed with dms, o64

Details for d3ovxa_

PDB Entry: 3ovx, 1.49 Å

PDB Description: Cathepsin S in complex with a covalent inhibitor with an aldehyde warhead

PDB Compounds: (A:) cathepsin S

SCOPe Domain Sequences for d3ovxa_:

Sequence; same for both SEQRES and ATOM records:

>d3ovxa_ d.3.1.1 (A:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d3ovxa_:

• d3ovxa_ first appeared in SCOPe 2.01
  
• d3ovxa_ appears in SCOPe 2.05
  
• d3ovxa_ appears in SCOPe 2.07
  
• d3ovxa_ appears in the current release, SCOPe 2.08