Lineage for d3ovrb_ (3ovr B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090271Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2091023Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2091024Protein automated matches [190292] (34 species)
    not a true protein
  7. 2091154Species Human (Homo sapiens) [TaxId:9606] [189658] (4 PDB entries)
  8. 2091162Domain d3ovrb_: 3ovr B: [183325]
    automated match to d1h1ya_
    complexed with 5sp, fe2, xpe

Details for d3ovrb_

PDB Entry: 3ovr (more details), 1.95 Å

PDB Description: crystal structure of hrpe and d-xylulose 5-phosphate complex
PDB Compounds: (B:) ribulose-phosphate 3-epimerase

SCOPe Domain Sequences for d3ovrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ovrb_ c.1.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gckigpsilnsdlanlgaeclrmldsgadylhldvmdghfvpnitfghpvveslrkqlgq
dpffdmhmmvskpeqwvkpmavaganqytfhleatenpgalikdirengmkvglaikpgt
sveylapwanqidmalvmtvepgfggqkfmedmmpkvhwlrtqfpsldievdggvgpdtv
hkcaeaganmivsgsaimrsedprsvinllrnvcseaaqk

SCOPe Domain Coordinates for d3ovrb_:

Click to download the PDB-style file with coordinates for d3ovrb_.
(The format of our PDB-style files is described here.)

Timeline for d3ovrb_: