Lineage for d3ovqb_ (3ovq B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827466Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2827467Protein automated matches [190292] (36 species)
    not a true protein
  7. 2827566Species Human (Homo sapiens) [TaxId:9606] [189658] (4 PDB entries)
  8. 2827572Domain d3ovqb_: 3ovq B: [183323]
    automated match to d1h1ya_
    complexed with 5rp, fe2, xpe

Details for d3ovqb_

PDB Entry: 3ovq (more details), 2 Å

PDB Description: crystal structure of hrpe and d-ribulose-5-phospate complex
PDB Compounds: (B:) ribulose-phosphate 3-epimerase

SCOPe Domain Sequences for d3ovqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ovqb_ c.1.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ckigpsilnsdlanlgaeclrmldsgadylhldvmdghfvpnitfghpvveslrkqlgqd
pffdmhmmvskpeqwvkpmavaganqytfhleatenpgalikdirengmkvglaikpgts
veylapwanqidmalvmtvepgfggqkfmedmmpkvhwlrtqfpsldievdggvgpdtvh
kcaeaganmivsgsaimrsedprsvinllrnvcseaaqk

SCOPe Domain Coordinates for d3ovqb_:

Click to download the PDB-style file with coordinates for d3ovqb_.
(The format of our PDB-style files is described here.)

Timeline for d3ovqb_: