Lineage for d3ovnb_ (3ovn B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1859358Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 1859359Protein Retroviral integrase, catalytic domain [53108] (4 species)
  7. 1859365Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (44 PDB entries)
  8. 1859404Domain d3ovnb_: 3ovn B: [183319]
    automated match to d1bi4c_
    protein/DNA complex; complexed with cd, mpv, so4, suc

Details for d3ovnb_

PDB Entry: 3ovn (more details), 1.95 Å

PDB Description: fragment-based approach to the design of ligands targeting a novel site on hiv-1 integrase
PDB Compounds: (B:) Pol polyprotein

SCOPe Domain Sequences for d3ovnb_:

Sequence, based on SEQRES records: (download)

>d3ovnb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records): (download)

>d3ovnb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacdwagikqedesmnkelkkiigqvrdqaehlktavqmavfihnhkrk
ggiggysagerivdiiatdiq

SCOPe Domain Coordinates for d3ovnb_:

Click to download the PDB-style file with coordinates for d3ovnb_.
(The format of our PDB-style files is described here.)

Timeline for d3ovnb_: