Lineage for d3ovmb_ (3ovm B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1587349Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1587501Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. 1587557Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)
  7. 1587558Species Human (Homo sapiens) [TaxId:9606] [52241] (44 PDB entries)
  8. 1587623Domain d3ovmb_: 3ovm B: [183317]
    automated match to d1qr2a_
    complexed with fad, mzc, zn

Details for d3ovmb_

PDB Entry: 3ovm (more details), 2.09 Å

PDB Description: x-ray structural study of quinone reductase ii inhibition by compounds with micromolar to nanomolar range ic50 values
PDB Compounds: (B:) Ribosyldihydronicotinamide dehydrogenase [quinone]

SCOPe Domain Sequences for d3ovmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ovmb_ c.23.5.3 (B:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
gkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtlsn
pevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvlc
qgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcgf
kvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfg

SCOPe Domain Coordinates for d3ovmb_:

Click to download the PDB-style file with coordinates for d3ovmb_.
(The format of our PDB-style files is described here.)

Timeline for d3ovmb_: