Lineage for d1eiaa2 (1eia A:16-147)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
core: 5 helices; bundleSuperfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) 
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 protein domains) 
Protein EIAV capsid protein p26 [47947] (1 species) Species Equine infectious anemia virus [TaxId:11665] [47948] (2 PDB entries) 
Domain d1eiaa2: 1eia A:16-147 [18331]
Other proteins in same PDB: d1eiaa1
Details for d1eiaa2
PDB Entry: 1eia (more details), 2.7 Å
PDB Description: x-ray crystal structure of equine infectious anemia virus (eiav) capsid protein p26
PDB Compounds: (A:) eiav capsid protein p26SCOPe Domain Sequences for d1eiaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eiaa2 a.73.1.1 (A:16-147) EIAV capsid protein p26 {Equine infectious anemia virus [TaxId: 11665]}
tprgyttwvntiqtngllneasqnlfgilsvdctseemnafldvvpgqagqkqilldaid
kiaddwdnrhplpnaplvappqgpipmtarfirglgvprerqmepafdqfrqtyrqwiie
amsegikvmigk
SCOPe Domain Coordinates for d1eiaa2:
Click to download the PDB-style file with coordinates for d1eiaa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eiaa2:
- d1eiaa2 first appeared (with stable ids) in SCOP 1.55, called d1eia_2
- d1eiaa2 appears in SCOPe 2.06
View in 3D
