Lineage for d3ouxa_ (3oux A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2332676Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2332677Protein beta-Catenin [48373] (2 species)
  7. 2332694Species Mouse (Mus musculus) [TaxId:10090] [48374] (13 PDB entries)
  8. 2332708Domain d3ouxa_: 3oux A: [183309]
    automated match to d1g3ja_

Details for d3ouxa_

PDB Entry: 3oux (more details), 2.4 Å

PDB Description: structure of beta-catenin with phosphorylated lef-1
PDB Compounds: (A:) Catenin beta-1

SCOPe Domain Sequences for d3ouxa_:

Sequence, based on SEQRES records: (download)

>d3ouxa_ a.118.1.1 (A:) beta-Catenin {Mouse (Mus musculus) [TaxId: 10090]}
raipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndvet
arctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqegak
mavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimrt
ytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnlsd
aatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvrt
vlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplikat
vglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmggtqqqfvegvrmeeiv
egctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaea
ieaegatapltellhsrnegvatyaaavlfrmsed

Sequence, based on observed residues (ATOM records): (download)

>d3ouxa_ a.118.1.1 (A:) beta-Catenin {Mouse (Mus musculus) [TaxId: 10090]}
raipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndvet
arctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqegak
mavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimrt
ytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnlsd
aatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvrt
vlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplikat
vglirnlalcpanhaplreqgaiprlvqllvrahqdtqregvrmeeivegctgalhilar
dvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegataplte
llhsrnegvatyaaavlfrmsed

SCOPe Domain Coordinates for d3ouxa_:

Click to download the PDB-style file with coordinates for d3ouxa_.
(The format of our PDB-style files is described here.)

Timeline for d3ouxa_: