Lineage for d3ourf_ (3our F:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1808932Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1809208Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families) (S)
    half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets
  5. 1809209Family b.84.3.1: Glucose permease-like [51262] (3 proteins)
  6. 1809230Protein automated matches [191300] (1 species)
    not a true protein
  7. 1809231Species Vibrio vulnificus [TaxId:216895] [189977] (1 PDB entry)
  8. 1809234Domain d3ourf_: 3our F: [183306]
    automated match to d1glaf_

Details for d3ourf_

PDB Entry: 3our (more details), 2.2 Å

PDB Description: Crystal structure of complex between EIIA and a novel pyruvate decarboxylase
PDB Compounds: (F:) Phosphotransferase system IIA component

SCOPe Domain Sequences for d3ourf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ourf_ b.84.3.1 (F:) automated matches {Vibrio vulnificus [TaxId: 216895]}
aieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvngtigkifetnhafs
iesddgvelfvhfgidtvelkgegftriaeegqtvkagdtviefdlalleekakstltpv
visnmdeikelnklsgsvvvgetpvlrvtk

SCOPe Domain Coordinates for d3ourf_:

Click to download the PDB-style file with coordinates for d3ourf_.
(The format of our PDB-style files is described here.)

Timeline for d3ourf_: