SCOPe 2.06: Domain d3ourd_: 3our D:

Lineage for d3ourd_ (3our D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families)
   half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets

5. Family b.84.3.1: Glucose permease-like [51262] (3 proteins)

6. Protein automated matches [191300] (1 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:216895] [189977] (1 PDB entry)

8. Domain d3ourd_: 3our D: [183305]
   automated match to d1glaf_

Details for d3ourd_

PDB Entry: 3our, 2.2 Å

PDB Description: Crystal structure of complex between EIIA and a novel pyruvate decarboxylase

PDB Compounds: (D:) Phosphotransferase system IIA component

SCOPe Domain Sequences for d3ourd_:

Sequence; same for both SEQRES and ATOM records:

>d3ourd_ b.84.3.1 (D:) automated matches {Vibrio vulnificus [TaxId: 216895]}
aieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvngtigkifetnhafs
iesddgvelfvhfgidtvelkgegftriaeegqtvkagdtviefdlalleekakstltpv
visnmdeikelnklsgsvvvgetpvlrvtk

Timeline for d3ourd_:

• d3ourd_ first appeared in SCOPe 2.01
  
• d3ourd_ appears in SCOPe 2.05
  
• d3ourd_ appears in SCOPe 2.07
  
• d3ourd_ appears in the current release, SCOPe 2.08