Class b: All beta proteins [48724] (177 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families) half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets |
Family b.84.3.1: Glucose permease-like [51262] (3 proteins) |
Protein automated matches [191300] (1 species) not a true protein |
Species Vibrio vulnificus [TaxId:216895] [189977] (1 PDB entry) |
Domain d3ourd_: 3our D: [183305] automated match to d1glaf_ |
PDB Entry: 3our (more details), 2.2 Å
SCOPe Domain Sequences for d3ourd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ourd_ b.84.3.1 (D:) automated matches {Vibrio vulnificus [TaxId: 216895]} aieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvngtigkifetnhafs iesddgvelfvhfgidtvelkgegftriaeegqtvkagdtviefdlalleekakstltpv visnmdeikelnklsgsvvvgetpvlrvtk
Timeline for d3ourd_: