SCOPe 2.01: Domain d3ourb_: 3our B:

Lineage for d3ourb_ (3our B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families)
   half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets

5. Family b.84.3.1: Glucose permease-like [51262] (3 proteins)

6. Protein automated matches [191300] (1 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:216895] [189977] (1 PDB entry)

8. Domain d3ourb_: 3our B: [183304]
   automated match to d1glaf_

Details for d3ourb_

PDB Entry: 3our, 2.2 Å

PDB Description: Crystal structure of complex between EIIA and a novel pyruvate decarboxylase

PDB Compounds: (B:) Phosphotransferase system IIA component

SCOPe Domain Sequences for d3ourb_:

Sequence; same for both SEQRES and ATOM records:

>d3ourb_ b.84.3.1 (B:) automated matches {Vibrio vulnificus [TaxId: 216895]}
aieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvngtigkifetnhafs
iesddgvelfvhfgidtvelkgegftriaeegqtvkagdtviefdlalleekakstltpv
visnmdeikelnklsgsvvvgetpvlrvtk

Timeline for d3ourb_:

• d3ourb_ is new in SCOPe 2.01-stable
  
• d3ourb_ appears in SCOPe 2.02
  
• d3ourb_ appears in the current release, SCOPe 2.08