| Class b: All beta proteins [48724] (174 folds) |
| Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) ![]() |
| Family b.52.2.0: automated matches [191648] (1 protein) not a true family |
| Protein automated matches [191195] (3 species) not a true protein |
| Species Francisella tularensis [TaxId:177416] [189506] (1 PDB entry) |
| Domain d3ougf_: 3oug F: [183299] automated match to d1pt1a_ complexed with cl, gol |
PDB Entry: 3oug (more details), 1.55 Å
SCOPe Domain Sequences for d3ougf_:
Sequence, based on SEQRES records: (download)
>d3ougf_ b.52.2.0 (F:) automated matches {Francisella tularensis [TaxId: 177416]}
mlisvlkskisyatvtgkdlfyvgsitidseimkqaniienekvqvvnlnngerletyvi
kgepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlk
>d3ougf_ b.52.2.0 (F:) automated matches {Francisella tularensis [TaxId: 177416]}
mlisvlkskisyatvtgkdlfyvsitidseimkqaniienekvqvvnlnngerletyvik
gepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlk
Timeline for d3ougf_: