Class b: All beta proteins [48724] (180 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.0: automated matches [191648] (1 protein) not a true family |
Protein automated matches [191195] (10 species) not a true protein |
Species Francisella tularensis [TaxId:177416] [189506] (1 PDB entry) |
Domain d3ougc_: 3oug C: [183297] automated match to d1pt1a_ complexed with cl, gol |
PDB Entry: 3oug (more details), 1.55 Å
SCOPe Domain Sequences for d3ougc_:
Sequence, based on SEQRES records: (download)
>d3ougc_ b.52.2.0 (C:) automated matches {Francisella tularensis [TaxId: 177416]} mlisvlkskisyatvtgkdlfyvgsitidseimkqaniienekvqvvnlnngerletyvi kgepnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlk
>d3ougc_ b.52.2.0 (C:) automated matches {Francisella tularensis [TaxId: 177416]} mlisvlkskisyatvtgkdlfysitidseimkqaniienekvqvvnlnngerletyvikg epnsktialngpaarrceigdqlfiisytqvdptrenikpklvdlk
Timeline for d3ougc_: